Skip to content

Phishing & Cybersecurity: Analysis for SMBs

Trends, analysis, and tips to protect your business against phishing.

SMBransomwarecybersecurityreal-casesFrance

10 French SMEs That Got Hacked: Real Stories That Should Keep You Up at Night

Lise Charmel, Clestra, Camaieu, Manutan... 10 real cases of French SMEs and mid-sized companies hit by cyberattacks. Ransomware, phishing, bankruptcy proceedings: what happened, what it cost, and what they should have done.

Read article
telecomsdata-breachescybersecurityoperatorsFreeSFR

Free, SFR, Orange, Bouygues: French Telecom Operators Under Siege from Cyberattacks

Full analysis of cyberattacks targeting French telecom operators: Free (19.2M customers), SFR, Orange, Bouygues, La Poste Mobile. Timeline, stolen data, IBAN fraud, SIM swapping, and protection measures.

Read article
CEO-fraudBECphishingcybersecurityscam

CEO Fraud and Targeted Phishing: The Most Costly BEC Cases in France

From Pathé (EUR 19.2M) to Vallourec (EUR 22M), a look back at the most expensive CEO fraud cases in France. Techniques, case law, and how to protect your business from BEC.

Read article
ransomwarecostcybersecurityFranceSMB

The Real Cost of Ransomware in France: Hard Numbers, Case Studies, and Ground-Level Reality

A thorough breakdown of ransomware costs in France: direct expenses, operational losses, legal fees, reputational damage, and hidden costs. Case studies from Manutan, Sopra Steria, Saint-Gobain, CHSF, Lise Charmel, and Clestra.

Read article
health-datacybersecurityhealthcareCNILHDS

Health Data: Why It Is the Number One Hacker Target in France

A medical record sells for up to $1,000 on the dark web, versus $5 for a credit card. Full analysis of cyberattacks against the French healthcare sector: Viamedis, AP-HP, CHSF Corbeil-Essonnes, HDS certification, the CaRE program, and concrete protection measures.

Read article
CNILGDPRfinespersonal-datacompliance

CNIL: The 20 Biggest GDPR Fines in France (and What They Teach Us)

Detailed analysis of the 20 largest CNIL sanctions in France: amounts, GDPR articles violated, company mistakes, and practical lessons for SMBs. From Google (150M euros) to Darty (100K euros).

Read article
hospitalsransomwarecybersecurityhealthcarehealth-data

Cyberattacks on French Hospitals: An Alarming Track Record (2019-2026)

From the Rouen University Hospital to the Cannes Hospital, a complete timeline of cyberattacks against French hospitals. Costs, patient impact, the role of phishing, and the government's response.

Read article
data-breacheshealthcarecybersecuritypersonal-datathird-party-payment

Viamedis and Almerys: 33 Million French Citizens Exposed by a Flaw at Two Health Insurance Processors

In February 2024, the health data of 33 million French citizens was compromised through Viamedis and Almerys. Timeline, stolen data, consequences, and lessons for businesses.

Read article
data-breachescybersecurityCNILFrancecyberattacks

The 50 Largest Data Breaches in France (2020-2026)

From France Travail (43M) to Viamedis (33M), a complete inventory of the 50 most massive data breaches in France. Timeline, figures, affected sectors, and lessons for your business.

Read article
data-breachesFrance-TravailcybersecurityphishingFrance

France Travail: 43 Million Records Stolen - A Complete Analysis

In-depth look at the France Travail breach of March 2024: timeline, stolen data, exploited vulnerabilities, consequences for 43 million victims, and lessons for businesses.

Read article
email securitySPFDKIMDMARCSMB

Email security for SMBs: why testing SPF, DKIM and DMARC is urgent

Most small and mid-sized businesses have no DMARC policy set to reject. That means anyone can send an email pretending to be you. Here is how to test your domain and fix the problem.

Read article
email headersphishingemail securityforensic analysis

How to Trace the Origin of a Suspicious Email Using Headers

Email headers reveal the real sender, the path taken, and authentication results. A step-by-step practical guide to analyzing the headers of a phishing email.

Read article
e-learningtrainingawarenesscybersecuritySME

Why a Simple E-Learning Module Is No Longer Enough to Train Your Teams on Cybersecurity

20% completion rates, 6-week retention, zero behavior change: why traditional e-learning fails against phishing and what alternatives actually work.

Read article
trainingsimulationawarenesscybersecuritySMB

Cybersecurity training vs phishing simulation: what's the difference, and what actually works?

E-learning, in-person workshops, phishing simulation: an objective comparison of security awareness methods with effectiveness data and ROI for SMBs.

Read article
simulationphishingcybersecurityguide

Phishing simulation for businesses: a practical 2026 guide

How to plan, run, and measure a phishing simulation campaign. Methodology, templates, timing, and results analysis for SMBs.

Read article
psychologyphishingcognitive-biasestrainingcybersecurity

Phishing Psychology: Why the Smartest People Still Click

The cognitive biases exploited by phishing: authority, urgency, social proof. Why intelligence doesn't protect you and how to train real reflexes.

Read article
quishingvishingsmishingphishingdeepfakecybersecurity

Malicious QR Codes, Voice Deepfakes, Trap SMS: New Forms of Phishing in 2026

Quishing, deepfake vishing, smishing, AI phishing: the 5 new threats bypassing traditional defenses. How to recognize them and protect yourself.

Read article
comparisonKnowBe4alternativesSMBawareness

KnowBe4 vs French Solutions: What SMBs Need to Compare

An objective comparison between KnowBe4 and French alternatives for SMBs. Pricing, GDPR, French language quality, support, and features.

Read article
comparisonphishingtoolbuying-guide

How to Choose a Phishing Awareness Solution in 2026

10 objective criteria for evaluating phishing simulation platforms. Scoring grid, pitfalls to avoid, and a comparison of leading solutions on the market.

Read article
cyber-insurancetrainingcomplianceSMBcybersecurity

Does Your Cyber Insurer Require Proof of Employee Training?

Cyber insurers now demand proof of security awareness training. How your training program lowers premiums and protects your claims.

Read article
phishingbenchmarksKPIcybersecurity

Phishing Click Rate: Industry Benchmarks and How to Reduce It

Is your click rate at 15%? Discover phishing benchmarks by industry and the methodology to get below 2% in 3 months.

Read article
cyberattackcostSMBcybersecuritycyber-insurance

What a Cyberattack Really Costs an SMB with 50 Employees

Detailed breakdown of the true cost of a cyberattack for a French SMB: direct costs, indirect costs, hidden costs, and comparison with the cost of prevention.

Read article
ROIcybersecuritybudgetmanagement

Cybersecurity Awareness ROI: How to Convince Your Management

Cybersecurity ROI calculation framework. Average incident cost, calculation formula, detailed examples by SMB size, and a ready-to-use business case template.

Read article
phishingstatisticscybersecuritySMB

Business Phishing: 2026 Statistics, Real-World Examples, and Solutions

91% of cyberattacks start with a phishing email. 2026 statistics, attack types, real-world examples from France, and solutions to protect your SMB.

Read article
trainingcybersecurityawarenessSMB

How to Train Your Employees on Cybersecurity: A Complete Guide for SMBs

A practical guide to building an effective cybersecurity awareness program. KPIs, frequency, budget, and mistakes to avoid for small and mid-sized businesses.

Read article